PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 91aa    MW: 10157.8 Da    PI: 10.394
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00496.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.96.3e-291059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n++ rqvtfskRrngi+KKA EL +LCdaev ++ifsstg+lyey+s
  Pahal.G00496.1 10 RIDNSTSRQVTFSKRRNGIFKKARELAILCDAEVGLVIFSSTGRLYEYAS 59
                    8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.791161IPR002100Transcription factor, MADS-box
CDDcd002653.34E-43274No hitNo description
SuperFamilySSF554552.09E-33283IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KARELAILCD AEVGLVIFSS TGRLYEYAST  60
SMKSVIDRYG RAKEEEQLVA NPSTELKVCL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S7e-22181181Myocyte-specific enhancer factor 2B
1tqe_R7e-22181181Myocyte-specific enhancer factor 2B
1tqe_Q7e-22181181Myocyte-specific enhancer factor 2B
1tqe_P7e-22181181Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283381e-82KJ728338.1 Zea mays clone pUT6619 MADS transcription factor (MADS63) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446622.19e-56hypothetical protein SORBIDRAFT_06g019040
SwissprotQ6EP492e-53MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLQ0JCM84e-57Q0JCM8_ORYSJ; Os04g0461300 protein
STRINGSb06g019040.13e-55(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.18e-46AGAMOUS-like 21